General Information

  • ID:  hor005661
  • Uniprot ID:  P83057
  • Protein name:  Kininogen-2-associated peptide
  • Gene name:  NA
  • Organism:  Bombina variegata (Yellow-bellied toad)
  • Family:  Bradykinin-related peptide family
  • Source:  animal
  • Expression:  Expressed by the skin glands.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Bombina (genus), Bombinatoridae (family), Anura (order), Batrachia (superorder), Amphibia (class), Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0090729 toxin activity
  • GO BP:  GO:0006952 defense response; GO:0007165 signal transduction; GO:0035821 modulation of process of another organism; GO:0042311 vasodilation; GO:0097746 blood vessel diameter maintenance
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  FKAPYNIHWHCKPGLLC
  • Length:  17
  • Propeptide:  MILWFCLNFLIVLCLEHFPGTLAAERNVPQSEEKTEQFLRDLSEISRLQRVPTGFTPFRGKFHSQSLRGLSETKKFKAPYNIHWHCKPGLLCKNFN
  • Signal peptide:  MILWFCLNFLIVLCLEHFPGTLA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  [Val1,Thr3,Thr6]bradykinin: produces in vitro relaxation of rat arterial smooth muscle and constriction of intestinal smooth muscle. May target bradykinin receptors (BDKRB).
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P83057-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor005661_AF2.pdbhor005661_ESM.pdb

Physical Information

Mass: 231302 Formula: C96H139N25O20S2
Absent amino acids: DEMQRSTV Common amino acids: CHKLP
pI: 8.8 Basic residues: 4
Polar residues: 5 Hydrophobic residues: 6
Hydrophobicity: -10.59 Boman Index: -182
Half-Life: 1.1 hour Half-Life Yeast: 3 min
Half-Life E.Coli: 2 min Aliphatic Index 74.71
Instability Index: 5280.59 Extinction Coefficient cystines: 7115
Absorbance 280nm: 444.69

Literature

  • PubMed ID:  12230583
  • Title:  Novel bradykinins and their precursor cDNAs from European yellow-bellied toad (Bombina variegata) skin.